Junctophilin 1 antibody (C-Term)

Catalog No. ABIN635471

The Rabbit Polyclonal anti-Junctophilin 1 antibody is suitable to detect Junctophilin 1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for Junctophilin 1 antibody (C-Term) (ABIN635471)

Target: Junctophilin 1 (JPH1)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Junctophilin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Junctophilin 1 Antibody

Binding Specificity: C-Term

Specificity: Junctophilin 1 antibody was raised against the C terminal of JPH1

Purification: Affinity purified

Immunogen: Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Junctophilin 1 Blocking Peptide, (ABIN5614247), is also available for use as a blocking control in assays to test for specificity of this Junctophilin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Junctophilin 1

Target: Junctophilin 1 (JPH1)

Alternative Name: Junctophilin 1

Background: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH1 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.

Molecular Weight: 72 kDa (MW of target protein)