ATP4b antibody (Middle Region)

Catalog No. ABIN635524

This Rabbit Polyclonal antibody specifically detects ATP4b in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for ATP4b antibody (Middle Region) (ABIN635524)

Target: ATP4b (ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP4b antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATP4b Antibody

Binding Specificity: Middle Region

Specificity: ATP4 B antibody was raised against the middle region of ATP4

Purification: Affinity purified

Immunogen: ATP4 B antibody was raised using the middle region of ATP4 corresponding to a region with amino acids QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP4B Blocking Peptide, (ABIN5612220), is also available for use as a blocking control in assays to test for specificity of this ATP4B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP4b

Target: ATP4b (ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b))

Alternative Name: ATP4B

Background: ATP4B belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Proton Transport