Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

HAVCR1 antibody

Antigen

HAVCR1

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN635773
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR
Description HAVCR1 may play a role in T-helper cell development and the regulation of asthma and allergic diseases. HAVCR1 is the receptor for TIMD4. In case of human hepatitis A virus (HHAV) infection, it functions as a cell-surface receptor for the virus.
Molecular Weight 39 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAVCR1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "HAVCR1", type "Antibodies"
Hosts Mouse (2)
Reactivities Human (2)
Applications ELISA (2), Western Blotting (WB) (2)