TBL2 antibody

Catalog No. ABIN635791

This Rabbit Polyclonal antibody specifically detects TBL2 in WB. It exhibits reactivity toward Human.

Quick Overview for TBL2 antibody (ABIN635791)

Target: TBL2 (Transducin (Beta)-Like 2 (TBL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TBL2 Antibody

Purification: Affinity purified

Immunogen: TBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBL2 Blocking Peptide, (ABIN5616522), is also available for use as a blocking control in assays to test for specificity of this TBL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBL2

Target: TBL2 (Transducin (Beta)-Like 2 (TBL2))

Alternative Name: TBL2

Background: TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.

Molecular Weight: 49 kDa (MW of target protein)