UQCR10 antibody

Catalog No. ABIN635794

This Rabbit Polyclonal antibody specifically detects UQCR10 in WB. It exhibits reactivity toward Human.

Quick Overview for UQCR10 antibody (ABIN635794)

Target: UQCR10 (Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UQCR10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UQCR10 Antibody

Purification: Affinity purified

Immunogen: UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UCRC Blocking Peptide, (ABIN940332), is also available for use as a blocking control in assays to test for specificity of this UCRC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCRC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UQCR10

Target: UQCR10 (Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10))

Alternative Name: UCRC

Background: UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.

Molecular Weight: 7 kDa (MW of target protein)