Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Glycoprotein antibody

Antigen

Glycoprotein

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Immunohistochemistry (IHC), Western Blotting (WB)
Catalog no. ABIN635807
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN
Description GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential.
Molecular Weight 60 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPNMB antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "Glycoprotein", type "Antibodies"
Hosts Rabbit (4)
Applications Western Blotting (WB) (4), ELISA (2)
Conjugates Biotin (1), HRP (1)