Membrane transport protein XK (XK) antibody

Catalog No. ABIN635847

The Rabbit Polyclonal anti-Membrane transport protein XK antibody (ABIN635847) specifically detects Membrane transport protein XK in WB. The antibody is reactive with Human samples.

Quick Overview for Membrane transport protein XK (XK) antibody (ABIN635847)

Target: Membrane transport protein XK (XK)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Purification: Affinity purified

Immunogen: XK antibody was raised using a synthetic peptide corresponding to a region with amino acids QMPKNGLSEEIEKEVGQAEGKLITHRSAFSRASVIQAFLGSAPQLTLQLY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XK Blocking Peptide, (ABIN5617039), is also available for use as a blocking control in assays to test for specificity of this XK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Membrane transport protein XK (XK)

Alternative Name: XK

Background: This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. XK has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx).

Molecular Weight: 51 kDa (MW of target protein)