KDELR3 antibody

Catalog No. ABIN636049

This Rabbit Polyclonal antibody specifically detects KDELR3 in WB. It exhibits reactivity toward Human.

Quick Overview for KDELR3 antibody (ABIN636049)

Target: KDELR3 (kDELR3) (KDEL (Lys-Asp-Glu-Leu) Endoplasmic Reticulum Protein Retention Receptor 3 (kDELR3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KDELR3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KDELR3 Antibody

Purification: Affinity purified

Immunogen: KDELR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KDELR3 Blocking Peptide, (ABIN937021), is also available for use as a blocking control in assays to test for specificity of this KDELR3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KDELR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KDELR3

Target: KDELR3 (kDELR3) (KDEL (Lys-Asp-Glu-Leu) Endoplasmic Reticulum Protein Retention Receptor 3 (kDELR3))

Alternative Name: KDELR3

Background: Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (kDaEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognises, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the kDaEL receptor gene family, have been described. kDaELR3 was the third member of the family to be identified, and it encodes a protein highly homologous to kDaELR1 and kDaELR2 proteins.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Maintenance of Protein Location