Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ARSE antibody

Antigen

ARSE

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN636061
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen ARSE antibody was raised using a synthetic peptide corresponding to a region with amino acids KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS
Description Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.
Molecular Weight 62 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARSE antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Organogenesis, Organelles

Alternatives

Alternatives for antigen "ARSE", type "Antibodies"
Hosts Rabbit (1)
Reactivities Human (1)
Applications ELISA (1), Western Blotting (WB) (1)