IL13RA2 antibody (Middle Region)

Catalog No. ABIN636087

The Rabbit Polyclonal anti-IL13RA2 antibody (ABIN636087) specifically detects IL13RA2 in WB. The antibody is reactive with Human samples.

Quick Overview for IL13RA2 antibody (Middle Region) (ABIN636087)

Target: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL13RA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IL13RA2 Antibody

Binding Specificity: Middle Region

Specificity: IL13 RA2 antibody was raised against the middle region of IL13 A2

Purification: Affinity purified

Immunogen: IL13 RA2 antibody was raised using the middle region of IL13 A2 corresponding to a region with amino acids GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL13RA2 Blocking Peptide, (ABIN938891), is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL13RA2

Target: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Alternative Name: IL13RA2

Background: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Molecular Weight: 42 kDa (MW of target protein)