ILDR1 antibody (Middle Region)

Catalog No. ABIN636101

The Rabbit Polyclonal anti-ILDR1 antibody is suitable to detect ILDR1 in samples from Human. It has been validated for WB.

Quick Overview for ILDR1 antibody (Middle Region) (ABIN636101)

Target: ILDR1 (Immunoglobulin-Like Domain Containing Receptor 1 (ILDR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ILDR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ILDR1 Antibody

Binding Specificity: Middle Region

Specificity: ILDR1 antibody was raised against the middle region of ILDR1

Purification: Affinity purified

Immunogen: ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ILDR1 Blocking Peptide, (ABIN5614180), is also available for use as a blocking control in assays to test for specificity of this ILDR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ILDR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ILDR1

Target: ILDR1 (Immunoglobulin-Like Domain Containing Receptor 1 (ILDR1))

Alternative Name: ILDR1

Background: ILDR1 is a putative membrane receptor.

Molecular Weight: 58 kDa (MW of target protein)