TSPAN33 antibody (Middle Region)

Catalog No. ABIN636117

The Rabbit Polyclonal anti-TSPAN33 antibody (ABIN636117) specifically detects TSPAN33 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for TSPAN33 antibody (Middle Region) (ABIN636117)

Target: TSPAN33 (Tetraspanin 33 (TSPAN33))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSPAN33 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TSPAN33 Antibody

Binding Specificity: Middle Region

Specificity: Tetraspanin 33 antibody was raised against the middle region of TSPAN33

Purification: Affinity purified

Immunogen: Tetraspanin 33 antibody was raised using the middle region of TSPAN33 corresponding to a region with amino acids LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 33 Blocking Peptide, (ABIN5616558), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSPAN33

Target: TSPAN33 (Tetraspanin 33 (TSPAN33))

Alternative Name: Tetraspanin 33

Background: TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.

Molecular Weight: 31 kDa (MW of target protein)