BCAP29 antibody (Middle Region)

Catalog No. ABIN636123

The Rabbit Polyclonal anti-BCAP29 antibody (ABIN636123) specifically detects BCAP29 in WB. The antibody is reactive with Human samples.

Quick Overview for BCAP29 antibody (Middle Region) (ABIN636123)

Target: BCAP29 (B-Cell Receptor-Associated Protein 29 (BCAP29))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCAP29 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BCAP29 Antibody

Binding Specificity: Middle Region

Specificity: BCAP29 antibody was raised against the middle region of BCAP29

Purification: Affinity purified

Immunogen: BCAP29 antibody was raised using the middle region of BCAP29 corresponding to a region with amino acids GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCAP29 Blocking Peptide, (ABIN939030), is also available for use as a blocking control in assays to test for specificity of this BCAP29 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAP29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCAP29

Target: BCAP29 (B-Cell Receptor-Associated Protein 29 (BCAP29))

Alternative Name: BCAP29

Background: BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.

Molecular Weight: 39 kDa (MW of target protein)