Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN785797

Selenoprotein P (SEPP1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SeP, SELP, Se-P, selp, AU018766, D15Ucla1, sepp1, MGC88974, SEPP1, SEP, DKFZp459B039
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN785797
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SEPP1 antibody: synthetic peptide directed towards the N terminal of human SEPP1
Sequence LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLN SNGSVTVVAL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SEPP1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SEPP1
Background SEPP1 is a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space.This gene encodes a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space. Several transcript variants, encoding either the same or different isoform, have been found for this gene.
Molecular Weight 46kDa
Gene ID 6414
NCBI Accession NP_001087195, NM_001093726
UniProt P49908
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SEPP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Peters, Chatterjee, Hayes et al.: "Variation in the selenoenzyme genes and risk of advanced distal colorectal adenoma." in: Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology, Vol. 17, Issue 5, pp. 1144-54, 2008 (PubMed).

Alternatives for antigen "Selenoprotein P (SEPP1)", type "Antibodies"
Hosts (5), (3)
Reactivities (7)
Applications (8), (3), (1), (1)
Epitopes (2), (1), (1), (1), (1)
Beacon