Selenoprotein P (SEPP1) (N-Term) antibody

Antigen: Selenoprotein P (SEPP1)

Synonyms: SeP, SELP, Se-P, selp, AU018766, D15Ucla1, SEPP1, MGC127167, sepp1, MGC88974, SEP, DKFZp459B039

Binding Site: N-Term

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN785797

Additional Information

Gene ID: SEPP1

Immunogen: The immunogen for anti-SEPP1 antibody: synthetic peptide directed towards the N terminal of human SEPP1

Sequence: LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLN SNGSVTVVAL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SEPP1 antibody concentration is 1 mg/ml.

Description: SEPP1 is a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space.This gene encodes a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space. Several transcript variants, encoding either the same or different isoform, have been found for this gene.

Characteristics: Antigen Size: 411 amino acids

Molecular Weight: 46kDa

Application Details

Application Notes: WB Suggested Anti-SEPP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SEPP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Publications

Product: Peters, Chatterjee, Hayes et al.: "Variation in the selenoenzyme genes and risk of advanced distal colorectal adenoma." in: Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology, Vol. 17, Issue 5, pp. 1144-54, 2008 (PubMed).