Selenoprotein P (SEPP1) (N-Term) antibody

Details for Product No. ABIN785797
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SeP, SELP, Se-P, selp, AU018766, D15Ucla1, sepp1, MGC88974, SEPP1, SEP, DKFZp459B039
Epitope
N-Term
(2), (1), (1), (1)
Reactivity
Human
(7)
Host
Rabbit
(5), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN785797
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SEPP1
Sequence LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLN SNGSVTVVAL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against SEPP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SEPP1
Background SEPP1 is a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space.This gene encodes a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space. Several transcript variants, encoding either the same or different isoform, have been found for this gene.
Molecular Weight 46 kDa
Gene ID 6414
NCBI Accession NM_001093726, NP_001087195
UniProt P49908
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 411 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Selenoprotein P (SEPP1) (N-Term) antibody WB Suggested Anti-SEPP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Peters, Chatterjee, Hayes et al.: "Variation in the selenoenzyme genes and risk of advanced distal colorectal adenoma." in: Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology, Vol. 17, Issue 5, pp. 1144-54, 2008 (PubMed).

Hosts (5), (3)
Reactivities (7)
Applications (8), (3), (1), (1)
Epitopes (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top