Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1048025

B-Defensin 2 (AA 4-41) Peptide

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Protein Region
AA 4-41
Origin
»Alternatives Human
Pubmed 1 reference available
Catalog no. ABIN1048025
Quantity 100 µg
Price
547.61 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 4 to 5 Business Days
Sequence DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Characteristics Synonyms: Beta-Defensin 2, beta 2, BD-2, Skin-antimicrobial peptide, SAP1
Purity > 95% (HPLC)
Restrictions For Research Use only
Format Lyophilized
Reconstitution Resuspend in 0.1% acetic acid for required concentration
Storage 4 °C
Product cited in: Langhorst, Junge, Rueffer et al.: "Elevated human beta-defensin-2 levels indicate an activation of the innate immune system in patients with irritable bowel syndrome." in: The American journal of gastroenterology, Vol. 104, Issue 2, pp. 404-10, 2009 (PubMed).

Alternatives for antigen "B-Defensin 2", type "Peptides"
Reactivities (1)
Beacon