B-Defensin 2 (AA 4-41) Peptide
| Name | B-Defensin 2 |
| Binding Site |
AA 4-41 |
| Origin (Gene) |
Human |
 |
1 reference available |
| Catalog no. | ABIN1048025 |
| Quantity |
|
| Price | 547.61 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 4 to 5 Business Days |
Additional Information
| UniProt | O15263 |
| Sequence | DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Format | Lyophilized |
| Reconstitution | Resuspend in 0.1% acetic acid for required concentration |
| Characteristics | Synonyms: Beta-Defensin 2, beta 2, BD-2, Skin-antimicrobial peptide, SAP1 |
Application Details
| Purity | > 95% (HPLC) |
| Storage | 2-8°C (lyophilized), -20°C (dissolved). Repeated thawing and freezing must be avoided |
| Restrictions | For Research Use only |
Publications
| Product |
Langhorst, Junge, Rueffer et al.: "Elevated human beta-defensin-2 levels indicate an activation of the innate immune system in patients with irritable bowel syndrome." in: The American journal of gastroenterology, Vol. 104, Issue 2, pp. 404-10, 2009 (PubMed).
|
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
