SRA1 antibody (Steroid Receptor RNA Activator 1) (AA 519-556)

Details for Product anti-SRA1 Antibody No. ABIN1742561
  • SRA
  • SRAP
  • STRAA1
  • pp7684
  • AA959952
  • Sra
  • Srap
  • Straa1
  • Strra1
  • zgc:86613
  • steroid receptor RNA activator 1
  • steroid receptor RNA activator 1 S homeolog
  • SRA1
  • Sra1
  • sra1
  • sra1.S
anti-Human SRA1 antibody for Western Blotting
AA 519-556
Human, Rat (Rattus), Mouse (Murine)
Clonality (Clone)
Monoclonal ()
This SRA1 antibody is un-conjugated
Immunoprecipitation (IP), ELISA, Western Blotting (WB)
Immunogen Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519-556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue.
Clone 30A4
Isotype IgG1
Specificity Specific for Sra 1
Cross-Reactivity (Details) may cross-react with CYFIP 2/PIR 121 due to high sequence homology.
Purification purified IgG. Azide was added before lyophilization.
Plasmids, Primers & others Plasmids, Primers & others SRA1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name Sra 1 (SRA1 Antibody Abstract)
Background Synonyms: CYFIP 1
Pathways EGFR Signaling Pathway, Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development
Application Notes WB: 1 : 100 up to 1 : 2000 (AP staining)
Restrictions For Research Use only
Format Lyophilized
Reconstitution For reconstitution add 100 µL H2O to get a 1mg/ml solution of antibody in PBS. Then aliquot and store at -20 °C until use.
Buffer PBS, 0.02% sodium azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Do not store diluted antibody solutions unless you add detergent or carrier proteins such as goat serum, BSA or others. IgG sticks to glass and plastic. Any IgG solution below 0.1 mg/mL protein will quickly adsorb and denature and thus loose activity! Repetitive freeze-thawing of dilute purified IgG is almost certain to lead to substantial losses.
Storage -20 °C
Storage Comment Unlabeled antibodies are stable in this form without loss of quality at ambient temperatures for several weeks or even months. They can be stored at 4 °C for several years.
Supplier Images
Western Blotting (WB) image for anti-Steroid Receptor RNA Activator 1 (SRA1) (AA 519-556) antibody (ABIN1742561) anti-Steroid Receptor RNA Activator 1 (SRA1) (AA 519-556) antibody
Product cited in: Bozdagi, Sakurai, Dorr, Pilorge, Takahashi, Buxbaum: "Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice." in: PLoS ONE, Vol. 7, Issue 8, pp. e42422, 2012 (PubMed).

Steffen, Faix, Resch, Linkner, Wehland, Small, Rottner, Stradal: "Filopodia formation in the absence of functional WAVE- and Arp2/3-complexes." in: Molecular biology of the cell, Vol. 17, Issue 6, pp. 2581-91, 2006 (PubMed).

Did you look for something else?