PTGER4 antibody

Catalog No. ABIN2451693

Product Details anti-PTGER4 Antibody

Target: PTGER4 (Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGER4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC)

Specificity: Does not cross-react with EP1, EP3, or EP4 receptors. The EP2 receptor appears to be expressed at low levels in many tissues and cell types, potentially making detection by immunochemical techniques difficult.

Cross-Reactivity: Mouse (Murine), Rat (Rattus), Sheep (Ovine)

Predicted Reactivity: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%) Gibbon, Bovine (97%) Rabbit (93%) Marmoset (90%) Bat, Hamster, Elephant, Panda (87%) Horse (83%) Mouse, Rat (80%).

Purification: Affinity Purified

Immunogen: Human EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI).

Isotype: IgG

Application Details

Application Notes: ICC, IHC-P (5 µg/mL), WB (1:200)

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: TBS, pH 7.4, 0.02% sodium azide, 0.5 mg/mL BSA, 50% glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.

Target Details for PTGER4

Target: PTGER4 (Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4))

Alternative Name: PTGER4 / EP4 (PTGER4 Products)

Background: Standard Gene Symbol: PTGER4, Gene Family: GPCR, Gene Subfamily: Prostanoid, Synonyms: PTGER4, EP4, EP4 prostaglandin receptor, EP4R, PGE receptor EP4 subtype, Prostanoid EP4 receptor, Prostaglandin E receptor 4, PGE receptor, EP4 subtype, PGE2 receptor EP4 subtype

Gene ID: 5734

UniProt: P35408