PTGER4 antibody (Prostaglandin E Receptor 4 (Subtype EP4))

Details for Product anti-PTGER4 Antibody No. ABIN2451693
Antigen
  • EP4
  • PGE2R-EP4
  • ptger4
  • ptger4l
  • PTGER4
  • EP4R
  • Ptgerep4
  • Ptger
  • ep4
  • prostaglandin E receptor 4
  • prostaglandin E receptor 4 (subtype EP4)
  • prostaglandin E receptor 4 (subtype EP4) a
  • prostaglandin E receptor 4 subtype EP4
  • PTGER4
  • ptger4a
  • ptger4
  • Ptger4
Reactivity
Human
84
12
10
7
2
1
1
1
1
1
1
Host
Rabbit
76
7
1
Clonality
Polyclonal
Conjugate
This PTGER4 antibody is un-conjugated
3
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
48
30
23
14
13
13
5
2
1
Options
Immunogen Human EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI).
Isotype IgG
Specificity Does not cross-react with EP1, EP3, or EP4 receptors. The EP2 receptor appears to be expressed at low levels in many tissues and cell types, potentially making detection by immunochemical techniques difficult.
Cross-Reactivity Mouse (Murine), Rat (Rattus), Sheep (Ovine)
Predicted Reactivity Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%) Gibbon, Bovine (97%) Rabbit (93%) Marmoset (90%) Bat, Hamster, Elephant, Panda (87%) Horse (83%) Mouse, Rat (80%).
Purification Affinity Purified
Plasmids, Primers & others Plasmids, Primers & others PTGER4 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name PTGER4 / EP4 (PTGER4 Antibody Abstract)
Background Standard Gene Symbol: PTGER4, Gene Family: GPCR, Gene Subfamily: Prostanoid, Synonyms: PTGER4, EP4, EP4 prostaglandin receptor, EP4R, PGE receptor EP4 subtype, Prostanoid EP4 receptor, Prostaglandin E receptor 4, PGE receptor, EP4 subtype, PGE2 receptor EP4 subtype
Gene ID 5734
UniProt P35408
Application Notes ICC, IHC-P (5 µg/mL), WB (1:200)
Restrictions For Research Use only
Format Liquid
Concentration Lot specific
Buffer TBS, pH 7.4, 0.02% sodium azide, 0.5 mg/mL BSA, 50% glycerol.
Preservative Sodium azide
Precaution of Use This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice avoid freeze thaw cycles.
Storage 4 °C/-20 °C
Storage Comment Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.
Supplier Images
Image no. 1 for anti-Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4) antibody (ABIN2451693) Anti-PTGER4 / EP4 antibody IHC staining of human prostate. Immunohistochemistry of fo...
Image no. 2 for anti-Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4) antibody (ABIN2451693) Anti-PTGER4 / EP4 antibody IHC of human prostate. Immunohistochemistry of formalin-fi...
Did you look for something else?