ICA1 antibody (Middle Region)
-
- Target See all ICA1 Antibodies
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
-
Binding Specificity
- AA 243-276, Middle Region
-
Reactivity
- Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ICA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- EKTSHTMAAI HESFKGYQPY EFTTLKSLQD PMKK
- Cross-Reactivity (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Characteristics
-
Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: islet cell autoantigen 1, 69 kDa
Protein Name: Islet cell autoantigen 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product ICA1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
- Alternative Name
- ICA1 (ICA1 Products)
- Background
-
Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
Synonyms: 69 kDa islet cell autoantigen antibody|Diabetes mellitus type I autoantigen antibody|ICA 1 antibody|Ica1 antibody|ICA69 antibody|ICA69_HUMAN antibody|ICAp69 antibody|Islet cell autoantigen 1 (69kD) antibody|Islet cell autoantigen 1 69 kDa antibody|Islet cell autoantigen 1 antibody|Islet cell autoantigen 1 isoform antibody|Islet cell autoantigen p69 antibody|OTTHUMP00000200933 antibody|OTTHUMP00000200934 antibody|OTTHUMP00000200941 antibody|OTTHUMP00000200993 antibody|p69 antibody - Gene ID
- 3382
- UniProt
- Q05084
-