ARID1A antibody (Middle Region)

Catalog No. ABIN3043527

Product Details anti-ARID1A Antibody

Target: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Binding Specificity: AA 1021-1053, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARID1A antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for AT-rich interactive domain-containing protein 1A(ARID1A) detection. Tested with WB in Human.

Sequence: KMWVDRYLAF TEEKAMGMTN LPAVGRKPLD LYR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for AT-rich interactive domain-containing protein 1A(ARID1A) detection. Tested with WB in Human.
Gene Name: AT rich interactive domain 1A (SWI-like)
Protein Name: AT-rich interactive domain-containing protein 1A

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ARID1A

Target: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Alternative Name: ARID1A (ARID1A Products)

Background: AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.

Synonyms: actin-dependent regulator of chromatin subfamily F member 1 antibody|ARI1A_HUMAN antibody| ARID domain containing protein 1A antibody|ARID domain-containing protein 1A antibody| ARID1A antibody|AT rich interactive domain 1A (SWI like) antibody|AT rich interactive domain 1A antibody|AT rich interactive domain containing protein 1A antibody|AT-rich interactive domain-containing protein 1A antibody|B120 antibody|BAF250 antibody|BAF250A antibody|BM029 antibody|brain protein 120 antibody|BRG1 associated factor 250 antibody|BRG1 associated factor 250a antibody|BRG1-associated factor 250 antibody|BRG1-associated factor 250a antibody|C1ORF4 antibody|chromatin remodeling factor p250 antibody|chromosome 1 open reading frame 4 antibody|hELD antibody|hOSA1 antibody|matrix-associated antibody|Osa homolog 1 antibody|OSA1 antibody|OSA1 nuclear protein antibody|P270 antibody|SMARCF1 antibody|SWI like protein antibody|SWI SNF complex protein p270 antibody|SWI-like protein antibody|SWI/SNF complex protein p270 antibody|SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1 antibody|SWI/SNF-related antibody

Gene ID: 8289

UniProt: O14497

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Tube Formation