PRKAB2 antibody (N-Term)

Catalog No. ABIN3043907

Product Details anti-PRKAB2 Antibody

Target: PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))

Binding Specificity: AA 56-89, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKAB2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-2(PRKAB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: DKEFVSWQQD LEDSVKPTQQ ARPTVIRWSE GGKE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-2(PRKAB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein kinase, AMP-activated, beta 2 non-catalytic subunit
Protein Name: 5'-AMP-activated protein kinase subunit beta-2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PRKAB2

Target: PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))

Alternative Name: PRKAB2 (PRKAB2 Products)

Background: 5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.

Synonyms: 5' AMP activated protein kinase beta 2 subunit antibody|5' AMP activated protein kinase subunit beta 2 antibody|5''-AMP-activated protein kinase subunit beta-2 antibody|AAKB2_HUMAN antibody|AMP activated protein kinase beta 2 non catalytic subunit antibody|AMPK beta 2 antibody|AMPK beta 2 chain antibody|AMPK subunit beta 2 antibody|AMPK subunit beta-2 antibody|MGC61468 antibody|PRKAB 2 antibody|Prkab2 antibody|Protein kinase AMP activated beta 2 non catalytic subunit antibody

Gene ID: 5565

UniProt: O43741

Pathways: AMPK Signaling, Warburg Effect