Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RPE antibody (Ribulose-5-Phosphate-3-Epimerase) AA 1-228 Primary Antibody

RPE Reactivity: Human IF, WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN519847
$611.43
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target See all RPE Antibodies
    RPE
    Binding Specificity
    • 10
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    AA 1-228
    Reactivity
    • 27
    • 10
    • 7
    • 7
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    Human
    Host
    • 25
    • 9
    • 3
    Mouse
    Clonality
    • 37
    Polyclonal
    Conjugate
    • 21
    • 5
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This RPE antibody is un-conjugated
    Application
    • 19
    • 14
    • 13
    • 11
    • 9
    • 3
    • 2
    • 2
    • 1
    • 1
    Immunofluorescence (IF), Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length human RPE protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: RPE (AAH16764, 1 a.a. ~ 228 a.a) full-length human protein.

    Immunogen Sequence: MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    RPE
    Alternative Name
    RPE (RPE Products)
    Synonyms
    wu:fa07h08, wu:fb93d11, wu:fc20b11, ik:tdsubc_2c8, xx:tdsubc_2c8, RPE2-1, 2810429B02Rik, 5730518J08Rik, ribulose-5-phosphate-3-epimerase, rpe, RPE, Rpe
    Background
    Full Gene Name: ribulose-5-phosphate-3-epimerase
    Synonyms: MGC2636,RPE2-1
    Gene ID
You are here:
help Support