RPE antibody (N-Term)

Catalog No. ABIN632630

Product Details anti-RPE Antibody

Target: RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPE antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPE antibody was raised against the N terminal of RPE

Purification: Affinity purified

Immunogen: RPE antibody was raised using the N terminal of RPE corresponding to a region with amino acids ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPE Blocking Peptide, catalog no. 33R-1339, is also available for use as a blocking control in assays to test for specificity of this RPE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPE

Target: RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))

Alternative Name: RPE (RPE Products)

Synonyms: wu:fa07h08 antibody, wu:fb93d11 antibody, wu:fc20b11 antibody, ik:tdsubc_2c8 antibody, xx:tdsubc_2c8 antibody, RPE2-1 antibody, 2810429B02Rik antibody, 5730518J08Rik antibody, ribulose-5-phosphate-3-epimerase antibody, rpe antibody, RPE antibody, Rpe antibody

Background: RPE is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle.

Molecular Weight: 19 kDa (MW of target protein)