PSMD6 antibody (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 6) (AA 1-389)

Details for Product anti-PSMD6 Antibody No. ABIN523276
Target
Binding Specificity
AA 1-389
15
10
9
4
2
2
1
1
1
1
1
1
Reactivity
Human
56
33
31
9
7
5
4
4
4
3
2
2
2
2
2
1
Host
Rabbit
54
3
Clonality
Polyclonal
Conjugate
This PSMD6 antibody is un-conjugated
4
3
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
45
24
13
8
5
3
2
1
1
1
Options
Purpose Rabbit polyclonal antibody raised against a full-length human PSMD6 protein.
Brand MaxPab®
Immunogen

immunogen: PSMD6 (NP_055629.1, 1 a.a. ~ 389 a.a) full-length human protein.

Immunogen Sequence: MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM

Cross-Reactivity Human
Target
Alternative Name PSMD6 (PSMD6 Antibody Abstract)
Background Full Gene Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
Synonyms: KIAA0107,Rpn7,S10,SGA-113M,p44S10
Gene ID 9861
NCBI Accession NP_055629, NM_014814
Pathways Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 6 (PSMD6) (AA 1-389) antibody (ABIN523276) Western Blot analysis of PSMD6 expression in transfected 293T cell line by PSMD6 MaxP...
Image no. 2 for anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 6 (PSMD6) (AA 1-389) antibody (ABIN523276) PSMD6 MaxPab rabbit polyclonal antibody. Western Blot analysis of PSMD6 expression in...