Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PPIE antibody (Peptidylprolyl Isomerase E (Cyclophilin E)) AA 1-301 Primary Antibody

PPIE Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN523848
$598.57
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target See all PPIE Antibodies
    PPIE
    Binding Specificity
    • 9
    • 9
    • 7
    • 6
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-301
    Reactivity
    • 41
    • 18
    • 18
    • 6
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 42
    • 5
    • 1
    Rabbit
    Clonality
    • 45
    • 3
    Polyclonal
    Conjugate
    • 29
    • 5
    • 5
    • 3
    • 2
    • 2
    • 2
    This PPIE antibody is un-conjugated
    Application
    • 38
    • 27
    • 9
    • 7
    • 6
    • 6
    • 4
    • 3
    Western Blotting (WB)
    Purpose
    Rabbit polyclonal antibody raised against a full-length human PPIE protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: PPIE (NP_006103.1, 1 a.a. ~ 301 a.a) full-length human protein.

    Immunogen Sequence: MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    PPIE
    Alternative Name
    PPIE (PPIE Products)
    Synonyms
    zgc:112471, CG4886, CYP33, Cyp33, Dcyp33, Dmel\\CG4886, PPIE, cyp-33, cyp33, cype, CYP-33, 2010010D16Rik, Ab1-210, peptidylprolyl isomerase E (cyclophilin E), cyclophilin-33, peptidylprolyl isomerase E, peptidylprolyl isomerase E (cyclophilin E) L homeolog, ppie, cyp33, PPIE, ppie.L, Ppie
    Background
    Full Gene Name: peptidylprolyl isomerase E (cyclophilin E)
    Synonyms: CYP-33,MGC111222,MGC3736
    Gene ID
    NCBI Accession
    NP_006103, NM_006112
You are here:
help Support