PPIE antibody (Peptidylprolyl Isomerase E (Cyclophilin E)) AA 1-301

Catalog No. ABIN523848

Product Details anti-PPIE Antibody

Target: PPIE

Binding Specificity: AA 1-301

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIE antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit polyclonal antibody raised against a full-length human PPIE protein.

Brand: MaxPab®

Cross-Reactivity: Human

Immunogen:

immunogen: PPIE (NP_006103.1, 1 a.a. ~ 301 a.a) full-length human protein.

Immunogen Sequence: MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions: For Research Use only

Handling

Buffer: In 1x PBS, pH 7.4

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details for PPIE

Target: PPIE

Alternative Name: PPIE (PPIE Products)

Synonyms: zgc:112471, CG4886, CYP33, Cyp33, Dcyp33, Dmel\\CG4886, PPIE, cyp-33, cyp33, cype, CYP-33, 2010010D16Rik, Ab1-210, peptidylprolyl isomerase E (cyclophilin E), cyclophilin-33, peptidylprolyl isomerase E, peptidylprolyl isomerase E (cyclophilin E) L homeolog, ppie, cyp33, PPIE, ppie.L, Ppie

Background: Full Gene Name: peptidylprolyl isomerase E (cyclophilin E)
Synonyms: CYP-33,MGC111222,MGC3736

Gene ID:

NCBI Accession: NP_006103, NM_006112