PPIE antibody

Catalog No. ABIN630008

The Rabbit Polyclonal anti-PPIE antibody is suitable to detect PPIE in samples from Human and Dog. It has been validated for WB and IHC.

Quick Overview for PPIE antibody (ABIN630008)

Target: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIE antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PPIE Antibody

Purification: Purified

Immunogen: PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPIE Blocking Peptide, (ABIN939848), is also available for use as a blocking control in assays to test for specificity of this PPIE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPIE

Target: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Alternative Name: PPIE

Background: PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain.

Molecular Weight: 33 kDa (MW of target protein)