ADAM29 antibody (ADAM Metallopeptidase Domain 29) (AA 339-398)

Details for Product anti-ADAM29 Antibody No. ABIN524502
Antigen
Epitope
AA 339-398
2
2
2
1
1
1
Reactivity
Human
23
3
3
2
1
1
1
1
1
1
Host
Mouse
18
5
Clonality (Clone)
Monoclonal ()
Conjugate
This ADAM29 antibody is un-conjugated
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
15
14
4
3
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant ADAM29.
Immunogen

immunogen: ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK

Clone 3A6
Isotype IgG1 kappa
Cross-Reactivity Human
Antigen
Alternative Name ADAM29 (ADAM29 Antibody Abstract)
Background Full Gene Name: ADAM metallopeptidase domain 29
Synonyms: svph1
Gene ID 11086
NCBI Accession NP_055084, NM_014269
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-ADAM Metallopeptidase Domain 29 (ADAM29) (AA 339-398) antibody (ABIN524502) Detection limit for recombinant GST tagged ADAM29 is 0.3 ng/ml as a capture antibody.
Image no. 2 for anti-ADAM Metallopeptidase Domain 29 (ADAM29) (AA 339-398) antibody (ABIN524502) Western Blot detection against Immunogen (32.34 KDa) .
Product cited in: Zhao, Jia, Jiang, Wang, DU, Cheng, Song: "ADAM29 Expression in Human Breast Cancer and its Effects on Breast Cancer Cells In Vitro." in: Anticancer research, Vol. 36, Issue 3, pp. 1251-8, 2016 (PubMed).