Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

TH1-Like antibody (TH1L) AA 491-590 Primary Antibody

TH1L Reactivity: Human ELISA Host: Mouse Monoclonal 3C9 unconjugated
Catalog No. ABIN526764
$611.43
Plus shipping costs $45.00
200 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target See all TH1-Like (TH1L) Antibodies
    TH1-Like (TH1L)
    Binding Specificity
    • 9
    • 8
    • 8
    • 7
    • 2
    • 2
    • 1
    • 1
    • 1
    AA 491-590
    Reactivity
    • 34
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 24
    • 7
    • 3
    Mouse
    Clonality
    • 33
    • 1
    Monoclonal
    Conjugate
    • 16
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    This TH1-Like antibody is un-conjugated
    Application
    • 33
    • 26
    • 2
    • 2
    • 1
    ELISA
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant TH1L.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: TH1L (NP_057481.2, 491 a.a. ~ 590 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: ELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN

    Clone
    3C9
    Isotype
    IgM kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In ascites fluid
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    TH1-Like (TH1L)
    Alternative Name
    TH1L (TH1L Products)
    Synonyms
    NELF-C, NELF-D, TH1, TH1L, 2410003I03Rik, C77797, Th1, Th1l, th1l, zgc:55482, negative elongation factor complex member C/D, negative elongation factor complex member C/D, Th1l, NELFCD, Nelfcd, nelfcd
    Background
    Full Gene Name: TH1-like (Drosophila)
    Synonyms: HSPC130,NELF-C,NELF-D,TH1
    Gene ID
    NCBI Accession
    NP_057481, NM_016397
You are here:
help Support