ATP1A2 antibody

Catalog No. ABIN5515377

Product Details anti-ATP1A2 Antibody

Target: ATP1A2 (ATPase, Na+/K+ Transporting, alpha 2 Polypeptide (ATP1A2))

Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP1A2 antibody is un-conjugated

Application: Please inquire

Sequence: ISLAYEAAES DIMKRQPRNS QTDKLVNERL ISMAYGQIGM IQALGGFFTY

Predicted Reactivity: Cow: 93%, Dog: 93%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 93%, Rat: 100%, Sheep: 93%, Zebrafish: 86%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY

Application Details

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Target Details for ATP1A2

Target: ATP1A2 (ATPase, Na+/K+ Transporting, alpha 2 Polypeptide (ATP1A2))

Alternative Name: ATP1A2 (ATP1A2 Products)

Background: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood.

Alias Symbols: FHM2, MHP2,

Protein Interaction Partner: UBC, LGR4, ZNRF2, ZNRF1, CAND1, CUL3, FBXO25, TPT1,

Protein Size: 1020

Gene ID: 477

NCBI Accession: NM_000702, NP_000693

UniProt: P50993

Pathways: Thyroid Hormone Synthesis, Proton Transport, Ribonucleoside Biosynthetic Process