TIMP3 antibody (Middle Region)
-
- Target See all TIMP3 Antibodies
- TIMP3 (TIMP Metallopeptidase Inhibitor 3 (TIMP3))
-
Binding Specificity
- AA 107-141, Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TIMP3 antibody is un-conjugated
-
Application
- Western Blotting (WB), ELISA
- Purpose
- Rabbit IgG polyclonal antibody for Metalloproteinase inhibitor 3(TIMP3) detection. Tested with WB, ELISA in Human,Mouse,Rat.
- Sequence
- RVYDGKMYTG LCNFVERWDQ LTLSQRKGLN YRYHL
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Metalloproteinase inhibitor 3(TIMP3) detection. Tested with WB, ELISA in Human,Mouse,Rat.
Gene Name: TIMP metallopeptidase inhibitor 3
Protein Name: Metalloproteinase inhibitor 3 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL), different from the related mouse and rat sequences by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product TIMP3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Promoter methylation and expression of TIMP3 gene in gastric cancer." in: Diagnostic pathology, Vol. 8, pp. 110, (2014) (PubMed).
: "Clinicopathologic significance of BAG1 and TIMP3 expression in colon carcinoma." in: World journal of gastroenterology, Vol. 13, Issue 28, pp. 3883-5, (2007) (PubMed).
: "
-
Promoter methylation and expression of TIMP3 gene in gastric cancer." in: Diagnostic pathology, Vol. 8, pp. 110, (2014) (PubMed).
-
- Target
- TIMP3 (TIMP Metallopeptidase Inhibitor 3 (TIMP3))
- Alternative Name
- TIMP3 (TIMP3 Products)
- Background
-
Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.
Synonyms: Metalloproteinase inhibitor 3 | Protein MIG-5 | Tissue inhibitor of metalloproteinases 3 | TIMP-3 | TIMP3 | P35625 - Gene ID
- 7078
- UniProt
- P35625
-