Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

IL10RB antibody (Interleukin 10 Receptor, beta) (AA 20-119) Primary Antibody

IL10RB Reactivity: Human ELISA, WB Host: Mouse Polyclonal unconjugated
Pubmed (3)
Catalog No. ABIN561469
$465.71
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    IL10RB
    Binding Specificity
    • 15
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    AA 20-119
    Reactivity
    • 37
    • 24
    • 16
    Human
    Host
    • 34
    • 5
    • 5
    • 1
    Mouse
    Clonality
    • 35
    • 10
    Polyclonal
    Conjugate
    • 19
    • 6
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This IL10RB antibody is un-conjugated
    Application
    • 20
    • 19
    • 16
    • 13
    • 13
    • 7
    • 4
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a partial recombinant IL10RB.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: IL10RB (NP_000619, 20 a.a. ~ 119 a.a) partial recombinant protein with GST tag.

    Immunogen Sequence: MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQ

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Pan, Thomson: "Nanog and transcriptional networks in embryonic stem cell pluripotency." in: Cell research, Vol. 17, Issue 1, pp. 42-9, 2007 (PubMed).

    Takahashi, Yamanaka: "Induction of pluripotent stem cells from mouse embryonic and adult fibroblast cultures by defined factors." in: Cell, Vol. 126, Issue 4, pp. 663-76, 2006 (PubMed).

    Boyer, Lee, Cole, Johnstone, Levine, Zucker, Guenther, Kumar, Murray, Jenner, Gifford, Melton, Jaenisch, Young: "Core transcriptional regulatory circuitry in human embryonic stem cells." in: Cell, Vol. 122, Issue 6, pp. 947-56, 2005 (PubMed).

  • Target
    IL10RB
    Alternative Name
    IL10RB (IL10RB Antibody Abstract)
    Synonyms
    IL10R2, IL10RB, il10r2, CDW210B, CRF2-4, CRFB4, D21S58, D21S66, IL-10R2, 6620401D04Rik, AI528744, Crfb4, D16H21S58, D21S58h, Il10r2, RGD1560373, interleukin 10 receptor subunit beta, interleukin 10 receptor subunit beta S homeolog, interleukin-10 receptor subunit beta, interleukin 10 receptor, beta, IL10RB, il10rb.S, LOC473966, LOC478404, il10rb, Il10rb
    Background
    Full Gene Name: interleukin 10 receptor, beta
    Synonyms: CDW210B,CRF2-4,CRFB4,D21S58,D21S66,IL-10R2
    Gene ID
    3588
    NCBI Accession
    NP_000619, NM_000628
You are here:
help Support