Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

IL15RA antibody (Interleukin 15 Receptor, alpha) (AA 31-130) Primary Antibody

IL15RA Reactivity: Human ELISA, WB Host: Mouse Monoclonal 1C5 unconjugated
Catalog No. ABIN561479
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    IL15RA
    Binding Specificity
    • 15
    • 10
    • 9
    • 9
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 31-130
    Reactivity
    • 51
    • 25
    • 12
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 47
    • 4
    • 3
    • 2
    Mouse
    Clonality
    • 50
    • 6
    Monoclonal
    Conjugate
    • 26
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This IL15RA antibody is un-conjugated
    Application
    • 39
    • 31
    • 13
    • 13
    • 6
    • 5
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant IL15RA.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: IL15RA (NP_002180, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA

    Clone
    1C5
    Isotype
    IgG2b kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    IL15RA
    Alternative Name
    IL15RA (IL15RA Antibody Abstract)
    Synonyms
    IL15RA, CD215, AA690181, IL-15RA, interleukin 15 receptor subunit alpha, interleukin 15 receptor, alpha chain, IL15RA, Il15ra
    Background
    Full Gene Name: interleukin 15 receptor, alpha
    Synonyms: MGC104179
    Gene ID
    3601
    NCBI Accession
    NP_002180, NM_002189
    Pathways
    JAK-STAT Signaling
You are here:
help Support