Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ITGA4 antibody (Integrin alpha 4) (AA 98-207) Primary Antibody

ITGA4 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 2C11 unconjugated
Catalog No. ABIN561542
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    ITGA4
    Binding Specificity
    • 16
    • 12
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 98-207
    Reactivity
    • 149
    • 117
    • 55
    • 19
    • 11
    • 9
    • 9
    • 8
    • 8
    • 7
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 75
    • 69
    • 64
    • 1
    • 1
    Mouse
    Clonality
    • 143
    • 67
    • 1
    Monoclonal
    Conjugate
    • 98
    • 25
    • 25
    • 15
    • 7
    • 6
    • 5
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This ITGA4 antibody is un-conjugated
    Application
    • 148
    • 51
    • 47
    • 45
    • 34
    • 24
    • 23
    • 13
    • 13
    • 12
    • 5
    • 4
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant ITGA4.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: ITGA4 (NP_000876, 98 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG

    Clone
    2C11
    Isotype
    IgG1 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    ITGA4
    Alternative Name
    ITGA4 (ITGA4 Antibody Abstract)
    Synonyms
    CD49D, IA4, LOC100219853, integrin subunit alpha 4, integrin alpha 4, integrin subunit alpha 4 S homeolog, ITGA4, Itga4, itga4.S
    Background
    Full Gene Name: integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor)
    Synonyms: CD49D,IA4,MGC90518
    Gene ID
    3676
    NCBI Accession
    NP_000876, NM_000885
    Pathways
    Integrin Complex
You are here:
help Support