Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

SMAD3 antibody (SMAD, Mothers Against DPP Homolog 3) (AA 1-110) Primary Antibody

SMAD3 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 4D4 unconjugated
Catalog No. ABIN561719
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target See all SMAD3 Antibodies
    SMAD3
    Binding Specificity
    • 33
    • 30
    • 29
    • 29
    • 21
    • 16
    • 13
    • 11
    • 11
    • 11
    • 10
    • 10
    • 10
    • 7
    • 5
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-110
    Reactivity
    • 270
    • 162
    • 147
    • 35
    • 15
    • 14
    • 12
    • 11
    • 10
    • 7
    • 5
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 255
    • 27
    Mouse
    Clonality
    • 245
    • 37
    Monoclonal
    Conjugate
    • 134
    • 21
    • 16
    • 14
    • 12
    • 10
    • 8
    • 8
    • 6
    • 6
    • 6
    • 6
    • 6
    • 4
    • 4
    • 4
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    This SMAD3 antibody is un-conjugated
    Application
    • 194
    • 127
    • 115
    • 81
    • 61
    • 56
    • 55
    • 53
    • 30
    • 13
    • 13
    • 10
    • 5
    • 5
    • 2
    • 2
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant SMAD3.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: SMAD3 (NP_005893, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCE

    Clone
    4D4
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    SMAD3
    Alternative Name
    SMAD3 (SMAD3 Products)
    Synonyms
    madh3, madh3a, smad3, wu:fa99e03, HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3, XSmad3, XenMLP, Xmad3, madh3-A, Madh3, AU022421, Smad 3, mad3, SMAD family member 3, SMAD family member 3a, SMAD family member 3 L homeolog, SMAD3, smad3a, smad3.L, Smad3
    Background
    Full Gene Name: SMAD family member 3
    Synonyms: DKFZp586N0721,DKFZp686J10186,HSPC193,HsT17436,JV15-2,MADH3,MGC60396
    Gene ID
    4088
    NCBI Accession
    NP_005893, NM_005902
    Pathways
    Cell Division Cycle, Chromatin Binding, Cell-Cell Junction Organization, Positive Regulation of Endopeptidase Activity, Autophagy
You are here:
help Support