MYBL2 antibody (V-Myb Myeloblastosis Viral Oncogene Homolog (Avian)-Like 2) (AA 601-700)

Details for Product anti-MYBL2 Antibody No. ABIN561889
Target
Binding Specificity
AA 601-700
19
15
10
8
8
6
4
3
3
2
2
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
94
76
67
5
4
4
4
4
3
3
2
1
Host
Mouse
86
8
7
Clonality (Clone)
Monoclonal ()
Conjugate
This MYBL2 antibody is un-conjugated
7
5
5
4
4
4
4
4
4
3
3
3
3
3
1
1
1
Application
ELISA, Western Blotting (WB)
53
37
32
15
15
11
6
4
2
2
2
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant MYBL2.
Immunogen

immunogen: MYBL2 (AAH53555, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS

Clone 4B4
Isotype IgG1 kappa
Cross-Reactivity Human
Target
Alternative Name MYBL2 (MYBL2 Antibody Abstract)
Background Full Gene Name: v-myb myeloblastosis viral oncogene homolog (avian)-like 2
Synonyms: B-MYB,BMYB,MGC15600
Gene ID 4605
Pathways Cell Division Cycle, Mitotic G1-G1/S Phases, Chromatin Binding
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-V-Myb Myeloblastosis Viral Oncogene Homolog (Avian)-Like 2 (MYBL2) (AA 601-700) antibody (ABIN561889) MYBL2 monoclonal antibody (M01), clone 4B4 Western Blot analysis of MYBL2 expression ...
Image no. 2 for anti-V-Myb Myeloblastosis Viral Oncogene Homolog (Avian)-Like 2 (MYBL2) (AA 601-700) antibody (ABIN561889) Detection limit for recombinant GST tagged MYBL2 is approximately 0.03ng/ml as a capt...