Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

NPY1R antibody (Neuropeptide Y Receptor Y1) (AA 1-115) Primary Antibody

NPY1R Reactivity: Human ELISA, WB Host: Mouse Monoclonal 2G2 unconjugated
Pubmed (1)
Catalog No. ABIN562042
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    NPY1R
    Binding Specificity
    • 15
    • 15
    • 9
    • 7
    • 6
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-115
    Reactivity
    • 57
    • 38
    • 37
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 70
    • 6
    • 1
    Mouse
    Clonality
    • 73
    • 4
    Monoclonal
    Conjugate
    • 37
    • 5
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    This NPY1R antibody is un-conjugated
    Application
    • 50
    • 35
    • 15
    • 13
    • 13
    • 12
    • 7
    • 5
    • 4
    • 3
    • 2
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant NPY1R.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: NPY1R (AAH36657, 1 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKL

    Clone
    2G2
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Igura, Haider, Ahmed, Sheriff, Ashraf: "Neuropeptide y and neuropeptide y y5 receptor interaction restores impaired growth potential of aging bone marrow stromal cells." in: Rejuvenation research, Vol. 14, Issue 4, pp. 393-403, 2011 (PubMed).

  • Target
    NPY1R
    Alternative Name
    NPY1R (NPY1R Antibody Abstract)
    Synonyms
    NPY1-R, NPYR, NPY-1, NPY1R, si:dkey-253i9.3, Npyr, Y1-R, npy1r-A, npyr, neuropeptide Y receptor Y1, neuropeptide Y receptor Y1 S homeolog, NPY1R, Npy1r, npy1r, npy1r.S
    Background
    Full Gene Name: neuropeptide Y receptor Y1
    Synonyms: NPYR
    Gene ID
    4886
    Pathways
    Negative Regulation of Hormone Secretion, Feeding Behaviour
You are here:
help Support