UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 3 (B3GNT3) (AA 135-208) antibody

Details for Product No. ABIN564488
Target
Binding Specificity
AA 135-208
4
2
1
1
1
Reactivity
Human
19
10
Host
Mouse
15
4
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
12
5
3
1
1
1
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant B3GNT3.
Immunogen

immunogen: B3GNT3 (NP_055071, 135 a.a. ~ 208 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN

Cross-Reactivity Human
Target
Alternative Name B3GNT3 (B3GNT3 Antibody Abstract)
Background Full Gene Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
Synonyms: B3GAL-T8,B3GN-T3,B3GNT-3,HP10328,TMEM3,beta3Gn-T3
Gene ID 10331
NCBI Accession NP_055071, NM_014256
Pathways Glycosaminoglycan Metabolic Process
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 3 (B3GNT3) (AA 135-208) antibody (ABIN564488) B3GNT3 polyclonal antibody (A01), Lot # 060519JCS1 Western Blot analysis of B3GNT3 ex...
Image no. 2 for anti-UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 3 (B3GNT3) (AA 135-208) antibody (ABIN564488) Western Blot detection against Immunogen (34.25 KDa) .