ATP-Binding Cassette, Sub-Family A (ABC1), Member 10 (ABCA10) (AA 1-80) antibody

Catalog No. ABIN564497

Product Details

Target:

ATP-Binding Cassette, Sub-Family A (ABC1), Member 10 (ABCA10)

Binding Specificity: AA 1-80

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: Un-conjugated

Application: ELISA, Western Blotting (WB)

Purpose: Mouse monoclonal antibody raised against a partial recombinant ABCA10.

Cross-Reactivity: Human

Immunogen:

immunogen: ABCA10 (NP_525021, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCYL

Clone: 8F4

Isotype: IgG2b kappa

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Buffer: In 1x PBS, pH 7.4

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details

Target:

ATP-Binding Cassette, Sub-Family A (ABC1), Member 10 (ABCA10)

Alternative Name: ABCA10 (ABCA10 Antibody Abstract)

Background: Full Gene Name: ATP-binding cassette, sub-family A (ABC1), member 10
Synonyms: EST698739

Gene ID: 10349

NCBI Accession: NP_525021, NM_080282