Pleckstrin Homology Domain Containing, Family B (Evectins) Member 1 (PLEKHB1) (AA 7-106) antibody

Details for Product No. ABIN566183
Antigen
Epitope
AA 7-106
8
Reactivity
Human
9
2
2
1
1
1
1
1
Host
Mouse
7
2
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
9
8
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant PLEKHB1.
Immunogen

immunogen: PLEKHB1 (NP_067023, 7 a.a. ~ 106 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: VPPDSALESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHFNVRDIKIGPECHDVQPPEGRSRDGLLTVNLREGGRL

Cross-Reactivity Human
Antigen
Alternative Name PLEKHB1 (PLEKHB1 Antibody Abstract)
Background Full Gene Name: pleckstrin homology domain containing, family B (evectins) member 1
Synonyms: KPL1,PHR1,PHRET1
Gene ID 58473
NCBI Accession NP_067023, NM_021200
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Pleckstrin Homology Domain Containing, Family B (Evectins) Member 1 (PLEKHB1) (AA 7-106) antibody (ABIN566183) Western Blot detection against Immunogen (37.11 KDa) .