CST4 antibody (N-Term)

Catalog No. ABIN630144

Product Details anti-CST4 Antibody

Target: CST4 (Cystatin S (CST4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CST4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cystatin S antibody was raised against the N terminal of CST4

Purification: Purified

Immunogen: Cystatin S antibody was raised using the N terminal of CST4 corresponding to a region with amino acids MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHF

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cystatin S Blocking Peptide, catalog no. 33R-5732, is also available for use as a blocking control in assays to test for specificity of this Cystatin S antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CST4

Target: CST4 (Cystatin S (CST4))

Alternative Name: Cystatin S (CST4 Products)

Synonyms: CST4 antibody, Cst4 antibody, cystatin S antibody, CST4 antibody, Cyss antibody

Background: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function.

Molecular Weight: 16 kDa (MW of target protein)