Cystatin S (CST4) (N-Term) antibody

Details for Product No. ABIN630144
Antigen
Epitope
N-Term
16
6
3
Reactivity
Human
81
10
2
Host
Rabbit
51
30
Clonality
Polyclonal
Conjugate
Un-conjugated
7
6
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
43
14
14
13
8
8
7
7
5
3
2
2
1
1
Options
Immunogen Cystatin S antibody was raised using the N terminal of CST4 corresponding to a region with amino acids MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHF
Specificity Cystatin S antibody was raised against the N terminal of CST4
Purification Purified
Antigen
Alternative Name Cystatin S (CST4 Antibody Abstract)
Background The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function.
Molecular Weight 16 kDa (MW of target protein)
Application Notes WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Cystatin S Blocking Peptide, catalog no. 33R-5732, is also available for use as a blocking control in assays to test for specificity of this Cystatin S antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Cystatin S (CST4) (N-Term) antibody (ABIN630144) Cystatin S antibody used at 1.25 ug/ml to detect target protein.