CST4 antibody (N-Term)
-
- Target See all CST4 Antibodies
- CST4 (Cystatin S (CST4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CST4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Cystatin S antibody was raised against the N terminal of CST4
- Purification
- Purified
- Immunogen
- Cystatin S antibody was raised using the N terminal of CST4 corresponding to a region with amino acids MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHF
- Top Product
- Discover our top product CST4 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cystatin S Blocking Peptide, catalog no. 33R-5732, is also available for use as a blocking control in assays to test for specificity of this Cystatin S antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CST4 (Cystatin S (CST4))
- Alternative Name
- Cystatin S (CST4 Products)
- Background
- The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function.
- Molecular Weight
- 16 kDa (MW of target protein)
-