Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH) antibody

Details for Product No. ABIN630169
Target
Reactivity
Human
28
11
3
1
Host
Rabbit
23
5
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
19
11
9
7
5
4
1
1
1
1
Options
Immunogen Granzyme H antibody was raised using a synthetic peptide corresponding to a region with amino acids MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG
Purification Purified
Target
Alternative Name Granzyme H (GZMH Antibody Abstract)
Background This enzyme is probably necessary for target cell lysis in cell-mediated immune responses.
Molecular Weight 27 kDa (MW of target protein)
Application Notes WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Granzyme H Blocking Peptide, catalog no. 33R-6337, is also available for use as a blocking control in assays to test for specificity of this Granzyme H antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMH antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH) antibody (ABIN630169) Granzyme H antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml...
Image no. 2 for anti-Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH) antibody (ABIN630169) Granzyme H antibody used at 2.5 ug/ml to detect target protein.