Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH) (AA 1-246) antibody

Details for Product No. ABIN516313
Target
Binding Specificity
AA 1-246
4
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human
29
11
3
1
Host
Mouse
24
5
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
Application
Western Blotting (WB)
20
12
9
7
5
4
1
1
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human GZMH protein.
Brand MaxPab®
Immunogen

immunogen: GZMH (AAH27974, 1 a.a. ~ 246 a.a) full-length human protein.

Immunogen Sequence: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL

Cross-Reactivity Human
Target
Alternative Name GZMH (GZMH Antibody Abstract)
Background Full Gene Name: granzyme H (cathepsin G-like 2, protein h-CCPX)
Synonyms: CCP-X,CGL-2,CSP-C,CTLA1,CTSGL2
Gene ID 2999
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Format Liquid
Buffer No additive
Preservative Without preservative
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH) (AA 1-246) antibody (ABIN516313) GZMH MaxPab polyclonal antibody. Western Blot analysis of GZMH expression in human sp...
Image no. 2 for anti-Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH) (AA 1-246) antibody (ABIN516313) GZMH MaxPab polyclonal antibody. Western Blot analysis of GZMH expression in human co...
Image no. 3 for anti-Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH) (AA 1-246) antibody (ABIN516313) Western Blot analysis of GZMH expression in transfected 293T cell line by GZMH MaxPab...