P Antigen Family, Member 1 (Prostate Associated) (PAGE1) antibody

Details for Product No. ABIN630210
Antigen
Reactivity
Human
35
1
1
1
Host
Rabbit
18
17
Clonality
Polyclonal
Conjugate
Un-conjugated
2
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
25
10
7
4
1
1
Options
Immunogen PAGE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN
Purification Purified
Antigen
Alternative Name PAGE1 (PAGE1 Antibody Abstract)
Background PAGE1 belongs to a family that are expressed in a variety of tumors but not in normal tissues, except for the testis. Nothing is presently known about the function of this protein.
Molecular Weight 16 kDa (MW of target protein)
Application Notes WB: 5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

PAGE1 Blocking Peptide, catalog no. 33R-9148, is also available for use as a blocking control in assays to test for specificity of this PAGE1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-P Antigen Family, Member 1 (Prostate Associated) (PAGE1) antibody (ABIN630210) PAGE1 antibody used at 5 ug/ml to detect target protein.