PAGE1 antibody
-
- Target See all PAGE1 Antibodies
- PAGE1 (P Antigen Family, Member 1 (Prostate Associated) (PAGE1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PAGE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- PAGE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN
- Top Product
- Discover our top product PAGE1 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PAGE1 Blocking Peptide, catalog no. 33R-9148, is also available for use as a blocking control in assays to test for specificity of this PAGE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAGE1 (P Antigen Family, Member 1 (Prostate Associated) (PAGE1))
- Alternative Name
- PAGE1 (PAGE1 Products)
- Background
- PAGE1 belongs to a family that are expressed in a variety of tumors but not in normal tissues, except for the testis. Nothing is presently known about the function of this protein.
- Molecular Weight
- 16 kDa (MW of target protein)
-