C-Type Lectin-Like 1 (CLECL1) (Middle Region) antibody

Details for Product No. ABIN630902
Antigen
Epitope
Middle Region
3
1
1
1
Reactivity
Human
8
Host
Rabbit
7
1
Clonality
Polyclonal
Application
Western Blotting (WB)
8
3
Options
Immunogen CLECL1 antibody was raised using the middle region of CLECL1 corresponding to a region with amino acids FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK
Specificity CLECL1 antibody was raised against the middle region of CLECL1
Purification Affinity purified
Antigen
Alternative Name CLECL1 (CLECL1 Antibody Abstract)
Background DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 production. DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells.
Molecular Weight 19 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CLECL1 Blocking Peptide, catalog no. 33R-3069, is also available for use as a blocking control in assays to test for specificity of this CLECL1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLECL1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-C-Type Lectin-Like 1 (CLECL1) (Middle Region) antibody (ABIN630902) CLECL1 antibody used at 1 ug/ml to detect target protein.