Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

C-Type Lectin-Like 1 (CLECL1) (AA 82-167) antibody Primary Antibody

CLECL1 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 4A12 unconjugated
Catalog No. ABIN1989545
$440.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    C-Type Lectin-Like 1 (CLECL1)
    Binding Specificity
    AA 82-167
    • 3
    • 2
    • 1
    Reactivity
    Human
    Host
    Mouse
    Clonality
    Monoclonal
    Application
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant CLECL1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: CLECL1 (NP_742001.1, 82 a.a. ~ 167 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: DVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI

    Clone
    4A12
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    C-Type Lectin-Like 1 (CLECL1)
    Alternative Name
    CLECL1 (CLECL1 Antibody Abstract)
    Synonyms
    DCAL-1, DCAL1, C-type lectin like 1, CLECL1
    Background
    Full Gene Name: C-type lectin-like 1
    Synonyms: DCAL1
    Gene ID
    160365
    NCBI Accession
    NP_742001, NM_172004
    OMIM
    607467
You are here:
help Support