C-Type Lectin-Like 1 (CLECL1) (AA 82-167) antibody

Details for Product No. ABIN1989545
Antigen
Epitope
AA 82-167
3
2
1
Reactivity
Human
8
Host
Mouse
8
Clonality (Clone)
Monoclonal ()
Application
ELISA, Western Blotting (WB)
8
2
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant CLECL1.
Immunogen

immunogen: CLECL1 (NP_742001.1, 82 a.a. ~ 167 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: DVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI

Clone 4A12
Isotype IgG2a kappa
Cross-Reactivity Human
Antigen
Alternative Name CLECL1 (CLECL1 Antibody Abstract)
Background Full Gene Name: C-type lectin-like 1
Synonyms: DCAL1
Gene ID 160365
NCBI Accession NP_742001, NM_172004
OMIM 607467
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-C-Type Lectin-Like 1 (CLECL1) (AA 82-167) antibody (ABIN1989545) Detection limit for recombinant GST tagged CLECL1 is 0.03 ng/ml as a capture antibody.
Image no. 2 for anti-C-Type Lectin-Like 1 (CLECL1) (AA 82-167) antibody (ABIN1989545) Western Blot detection against Immunogen (35.2 KDa) .