OXSM antibody (Middle Region)

Catalog No. ABIN630986

Product Details anti-OXSM Antibody

Target: OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OXSM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OXSM antibody was raised against the middle region of OXSM

Purification: Affinity purified

Immunogen: OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OXSM Blocking Peptide, catalog no. 33R-3696, is also available for use as a blocking control in assays to test for specificity of this OXSM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXSM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OXSM

Target: OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))

Alternative Name: OXSM (OXSM Products)

Synonyms: FASN2D antibody, KASI antibody, KS antibody, 4933425A18Rik antibody, C80494 antibody, RGD1311092 antibody, fatty acid synthase antibody, 3-oxoacyl-ACP synthase, mitochondrial antibody, FASN antibody, OXSM antibody, oxsm antibody, Oxsm antibody

Background: OXSM is a mitochondrial beta-ketoacyl synthase (EC 2.3.1.41) involved in mitochondrial fatty acid synthesis. It is required for catalysis of the chain-elongating condensation reaction.

Molecular Weight: 49 kDa (MW of target protein)