Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PFAS antibody (Phosphoribosylformylglycinamidine Synthase) Primary Antibody

PFAS Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN631263
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    PFAS
    Reactivity
    • 36
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 36
    Rabbit
    Clonality
    • 36
    Polyclonal
    Conjugate
    • 14
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This PFAS antibody is un-conjugated
    Application
    • 27
    • 21
    • 19
    • 17
    • 4
    • 1
    Western Blotting (WB)
    Purification
    Affinity purified
    Immunogen
    PFAS antibody was raised using a synthetic peptide corresponding to a region with amino acids ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    PFAS Blocking Peptide, catalog no. 33R-2731, is also available for use as a blocking control in assays to test for specificity of this PFAS antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFAS antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    PFAS
    Alternative Name
    PFAS (PFAS Antibody Abstract)
    Synonyms
    FGAMS, FGARAT, PURL, 4432409B16Rik, Gm18, Sofa, phosphoribosylformylglycinamidine synthase, phosphoribosylformylglycinamidine synthase (FGAR amidotransferase), Spirs_3128, PFAS, Pfas
    Background
    Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis.
    Molecular Weight
    145 kDa (MW of target protein)
You are here:
help Support