PFAS antibody
-
- Target See all PFAS Antibodies
- PFAS (Phosphoribosylformylglycinamidine Synthase (PFAS))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PFAS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PFAS antibody was raised using a synthetic peptide corresponding to a region with amino acids ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
- Top Product
- Discover our top product PFAS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PFAS Blocking Peptide, catalog no. 33R-2731, is also available for use as a blocking control in assays to test for specificity of this PFAS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFAS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PFAS (Phosphoribosylformylglycinamidine Synthase (PFAS))
- Alternative Name
- PFAS (PFAS Products)
- Background
- Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis.
- Molecular Weight
- 145 kDa (MW of target protein)
-