Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PRTFDC1 antibody (phosphoribosyl Transferase Domain Containing 1) (Middle Region) Primary Antibody

PRTFDC1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN631291
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    PRTFDC1
    Binding Specificity
    • 15
    • 9
    • 9
    • 7
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Middle Region
    Reactivity
    • 45
    • 22
    • 4
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Human
    Host
    • 57
    • 3
    Rabbit
    Clonality
    • 58
    • 2
    Polyclonal
    Conjugate
    • 24
    • 5
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    This PRTFDC1 antibody is un-conjugated
    Application
    • 38
    • 30
    • 13
    • 13
    • 4
    • 3
    • 3
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    PRTFDC1 antibody was raised against the middle region of PRTFDC1
    Purification
    Affinity purified
    Immunogen
    PRTFDC1 antibody was raised using the middle region of PRTFDC1 corresponding to a region with amino acids MKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYA
  • Application Notes
    WB: 0.5 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    PRTFDC1 Blocking Peptide, catalog no. 33R-6122, is also available for use as a blocking control in assays to test for specificity of this PRTFDC1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRTFDC1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    PRTFDC1
    Alternative Name
    PRTFDC1 (PRTFDC1 Antibody Abstract)
    Synonyms
    HHGP, HPRT, hprt1, hprt1l, zgc:55561, zgc:86771, MGC80959, OTTMUSG00000011667, Prtfdc1, phosphoribosyl transferase domain containing 1, phosphoribosyl transferase domain containing 1 L homeolog, phosphoribosyltransferase domain containing 1 pseudogene, PRTFDC1, prtfdc1, Prtfdc1, prtfdc1.L, Gm13377
    Background
    PRTFDC1 belongs to the purine/pyrimidine phosphoribosyltransferase family. Epigenetic silencing of PRTFDC1 by hypermethylation of the CpG islands leads to a loss of PRTFDC1 function, which might be involved in squamous cell oral carcinogenesis.
    Molecular Weight
    26 kDa (MW of target protein)
    Pathways
    Ribonucleoside Biosynthetic Process
You are here:
help Support