GNLY antibody (N-Term)

Catalog No. ABIN631324

Product Details anti-GNLY Antibody

Target: GNLY (Granulysin (GNLY))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNLY antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Granulysin antibody was raised against the n terminal of GNLY

Purification: Affinity purified

Immunogen: Granulysin antibody was raised using the N terminal of GNLY corresponding to a region with amino acids MASGPLGPGARPTRLHPPFPPPAHIKPGAPPGENPELSGLERILARHQLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Granulysin Blocking Peptide, catalog no. 33R-5745, is also available for use as a blocking control in assays to test for specificity of this Granulysin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNLY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNLY

Target: GNLY (Granulysin (GNLY))

Alternative Name: Granulysin (GNLY Products)

Background: GNLY is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. GNLY is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms.

Molecular Weight: 24 kDa (MW of target protein)