ATP6V0E2 antibody (Middle Region)

Catalog No. ABIN631416

Product Details anti-ATP6V0E2 Antibody

Target: ATP6V0E2 (ATPase, H+ Transporting V0 Subunit E2 (ATP6V0E2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP6V0E2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATP6 V6 2 antibody was raised against the middle region of ATP6 6 2

Purification: Affinity purified

Immunogen: ATP6 V6 2 antibody was raised using the middle region of ATP6 6 2 corresponding to a region with amino acids TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP6V0E2 Blocking Peptide, catalog no. 33R-9342, is also available for use as a blocking control in assays to test for specificity of this ATP6V0E2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP6V0E2

Target: ATP6V0E2 (ATPase, H+ Transporting V0 Subunit E2 (ATP6V0E2))

Alternative Name: ATP6V0E2 (ATP6V0E2 Products)

Background: Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport