Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Pseudouridylate Synthase 10 (PUS10) (Middle Region) antibody Primary Antibody

PUS10 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN631863
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Pseudouridylate Synthase 10 (PUS10)
    Binding Specificity
    Middle Region
    • 16
    • 9
    • 1
    • 1
    Reactivity
    Human
    • 37
    • 21
    • 18
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Host
    Rabbit
    • 37
    Clonality
    Polyclonal
    • 37
    Conjugate
    Un-conjugated
    • 9
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 25
    • 17
    • 13
    • 3
    • 3
    • 1
    Specificity
    PUS10 antibody was raised against the middle region of PUS10
    Purification
    Affinity purified
    Immunogen
    PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    PUS10 Blocking Peptide, catalog no. 33R-1592, is also available for use as a blocking control in assays to test for specificity of this PUS10 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS10 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Pseudouridylate Synthase 10 (PUS10)
    Alternative Name
    PUS10 (PUS10 Antibody Abstract)
    Synonyms
    CCDC139, DOBI, 2810013G11Rik, 4933435A13Rik, AU014648, C77560, Ccdc139, RGD1306402, pseudouridylate synthase 10, PUS10, Pus10
    Background
    Pseudouridination, the isomerization of uridine to pseudouridine, is the most common posttranscriptional nucleotide modification found in RNA and is essential for biologic functions such as spliceosome biogenesis. Pseudouridylate synthases, such as PUS10, catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicing RNAs. These enzymes also act as RNA chaperones, facilitating the correct folding and assembly of tRNAs.
    Molecular Weight
    60 kDa (MW of target protein)
You are here:
help Support