PUS10 antibody (Middle Region)

Catalog No. ABIN631863

Product Details anti-PUS10 Antibody

Target: PUS10 (Pseudouridylate Synthase 10 (PUS10))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PUS10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PUS10 antibody was raised against the middle region of PUS10

Purification: Affinity purified

Immunogen: PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PUS10 Blocking Peptide, catalog no. 33R-1592, is also available for use as a blocking control in assays to test for specificity of this PUS10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PUS10

Target: PUS10 (Pseudouridylate Synthase 10 (PUS10))

Alternative Name: PUS10 (PUS10 Products)

Background: Pseudouridination, the isomerization of uridine to pseudouridine, is the most common posttranscriptional nucleotide modification found in RNA and is essential for biologic functions such as spliceosome biogenesis. Pseudouridylate synthases, such as PUS10, catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicing RNAs. These enzymes also act as RNA chaperones, facilitating the correct folding and assembly of tRNAs.

Molecular Weight: 60 kDa (MW of target protein)